Lineage for d1k31a_ (1k31 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710068Family a.39.1.1: Calbindin D9K [47474] (2 proteins)
    made of two EF-hands only
  6. 2710095Protein automated matches [310844] (2 species)
    not a true protein
  7. 2710096Species Bos taurus [311153] (1 PDB entry)
  8. 2710097Domain d1k31a_: 1k31 A: [302611]
    automated match to d1cb1a_

Details for d1k31a_

PDB Entry: 1k31 (more details)

PDB Description: average nmr solution structure of ca ln calbindin d9k
PDB Compounds: (A:) vitamin d-dependent calcium-binding protein, intestinal

SCOPe Domain Sequences for d1k31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k31a_ a.39.1.1 (A:) automated matches {Bos taurus}
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgmstldelfeeldkngdge
vsfeefqvlvkkisq

SCOPe Domain Coordinates for d1k31a_:

Click to download the PDB-style file with coordinates for d1k31a_.
(The format of our PDB-style files is described here.)

Timeline for d1k31a_: