Lineage for d1jw7d_ (1jw7 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2103489Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2103543Species Helicobacter pylori [TaxId:210] [102151] (4 PDB entries)
  8. 2103550Domain d1jw7d_: 1jw7 D: [302606]
    automated match to d2pd4a_
    complexed with dcn, nad

Details for d1jw7d_

PDB Entry: 1jw7 (more details), 2.3 Å

PDB Description: Crystal structure of Enoyl-Acyl Carrier protein Reductase from Helicobacter pylori
PDB Compounds: (D:) Enoyl-ACP reductase

SCOPe Domain Sequences for d1jw7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jw7d_ c.2.1.2 (D:) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}
gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
evhfvdagyhvmgmgaveekdnkatllwdlhkeq

SCOPe Domain Coordinates for d1jw7d_:

Click to download the PDB-style file with coordinates for d1jw7d_.
(The format of our PDB-style files is described here.)

Timeline for d1jw7d_: