Lineage for d1jsba1 (1jsb A:6-73)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503006Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 2503025Family d.15.3.2: ThiS [54289] (5 protein domains)
  6. 2503050Protein automated matches [310843] (1 species)
    not a true protein
  7. 2503051Species Methanobacterium thermoautotrophicum [311152] (1 PDB entry)
  8. 2503052Domain d1jsba1: 1jsb A:6-73 [302601]
    Other proteins in same PDB: d1jsba2
    automated match to d1ryja_

Details for d1jsba1

PDB Entry: 1jsb (more details)

PDB Description: Solution Structure of Hypothetical Protein Mth1743 from Methanobacterium Thermoautotrophicum
PDB Compounds: (A:) Hypothetical protein Mth1743

SCOPe Domain Sequences for d1jsba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsba1 d.15.3.2 (A:6-73) automated matches {Methanobacterium thermoautotrophicum}
igmkftvitddgkkilesgaprrikdvlgeleipietvvvkkngqivideeeifdgdiie
virviygg

SCOPe Domain Coordinates for d1jsba1:

Click to download the PDB-style file with coordinates for d1jsba1.
(The format of our PDB-style files is described here.)

Timeline for d1jsba1:

  • d1jsba1 first appeared in SCOPe 2.06, called d1jsba_

View in 3D
Domains from same chain:
(mouse over for more information)
d1jsba2