SCOP 1.69: Domain d1hwze1: 1hwz E:209-501

Lineage for d1hwze1 (1hwz E:209-501)

Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

Protein Glutamate dehydrogenase [51884] (7 species)
Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)
Domain d1hwze1: 1hwz E:209-501 [30260]
Other proteins in same PDB: d1hwza2, d1hwzb2, d1hwzc2, d1hwzd2, d1hwze2, d1hwzf2

Details for d1hwze1

PDB Entry: 1hwz (more details), 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp

SCOP Domain Sequences for d1hwze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwze1 c.2.1.7 (E:209-501) Glutamate dehydrogenase {Cow (Bos taurus)}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOP Domain Coordinates for d1hwze1:

Click to download the PDB-style file with coordinates for d1hwze1.
(The format of our PDB-style files is described here.)

Timeline for d1hwze1: