SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jnac_ (1jna C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2152623Family d.2.1.2: C-type lysozyme [53960] (3 protein domains)
    automatically mapped to Pfam PF00062
  6. 2153662Protein automated matches [190299] (6 species)
    not a true protein
  7. 2153700Species Mus musculus [311150] (7 PDB entries)
  8. 2153712Domain d1jnac_: 1jna C: [302594]
    Other proteins in same PDB: d1jnab1, d1jnab2, d1jnad_
    automated match to d1yroa_
    complexed with bgn, ca

Details for d1jnac_

PDB Entry: 1jna (more details), 2.3 Å

PDB Description: beta-1,4-galactosyltransferase complex with alpha-lactalbumin and N-butanoyl-glucoamine
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1jnac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnac_ d.2.1.2 (C:) automated matches {Mus musculus}
teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1jnac_:

Click to download the PDB-style file with coordinates for d1jnac_.
(The format of our PDB-style files is described here.)

Timeline for d1jnac_:

  • d1jnac_ is new in SCOPe 2.06-stable