Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein automated matches [190299] (8 species) not a true protein |
Species Mus musculus [311150] (7 PDB entries) |
Domain d1jn8a_: 1jn8 A: [302587] Other proteins in same PDB: d1jn8b_, d1jn8d_ automated match to d1yroa_ complexed with ca, nag; mutant |
PDB Entry: 1jn8 (more details), 2 Å
SCOPe Domain Sequences for d1jn8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jn8a_ d.2.1.2 (A:) automated matches {Mus musculus} teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc ekp
Timeline for d1jn8a_: