Lineage for d1jmrb4 (1jmr B:76-246)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210555Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2210621Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. 2210628Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 2210642Species Thermotoga maritima [TaxId:2336] [75515] (2 PDB entries)
  8. 2210643Domain d1jmrb4: 1jmr B:76-246 [302585]
    Other proteins in same PDB: d1jmrb3, d1jmrb5
    automated match to d1mkmb2
    complexed with co2, zn

Details for d1jmrb4

PDB Entry: 1jmr (more details), 2.2 Å

PDB Description: Crystal Structure of the Thermotoga maritima IclR
PDB Compounds: (B:) IclR transcriptional regulator

SCOPe Domain Sequences for d1jmrb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmrb4 d.110.2.2 (B:76-246) Transcriptional regulator IclR, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystas
gksilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigim
cvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeeisrklgy

SCOPe Domain Coordinates for d1jmrb4:

Click to download the PDB-style file with coordinates for d1jmrb4.
(The format of our PDB-style files is described here.)

Timeline for d1jmrb4: