SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jmrb3 (1jmr B:1-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983141Family a.4.5.33: Transcriptional regulator IclR, N-terminal domain [74676] (1 protein)
  6. 1983142Protein Transcriptional regulator IclR, N-terminal domain [74677] (1 species)
  7. 1983143Species Thermotoga maritima [TaxId:2336] [74678] (2 PDB entries)
  8. 1983144Domain d1jmrb3: 1jmr B:1-75 [302584]
    Other proteins in same PDB: d1jmrb4, d1jmrb5
    automated match to d1mkmb1
    complexed with co2, zn

Details for d1jmrb3

PDB Entry: 1jmr (more details), 2.2 Å

PDB Description: Crystal Structure of the Thermotoga maritima IclR
PDB Compounds: (B:) IclR transcriptional regulator

SCOPe Domain Sequences for d1jmrb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmrb3 a.4.5.33 (B:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvp
gyklieygsfvlrrf

SCOPe Domain Coordinates for d1jmrb3:

Click to download the PDB-style file with coordinates for d1jmrb3.
(The format of our PDB-style files is described here.)

Timeline for d1jmrb3:

  • d1jmrb3 is new in SCOPe 2.06-stable