![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.33: Transcriptional regulator IclR, N-terminal domain [74676] (1 protein) |
![]() | Protein Transcriptional regulator IclR, N-terminal domain [74677] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [74678] (2 PDB entries) |
![]() | Domain d1jmrb3: 1jmr B:1-75 [302584] Other proteins in same PDB: d1jmrb4, d1jmrb5 automated match to d1mkmb1 complexed with co2, zn |
PDB Entry: 1jmr (more details), 2.2 Å
SCOPe Domain Sequences for d1jmrb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmrb3 a.4.5.33 (B:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvp gyklieygsfvlrrf
Timeline for d1jmrb3: