Lineage for d1jmrb3 (1jmr B:1-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693960Family a.4.5.33: Transcriptional regulator IclR, N-terminal domain [74676] (1 protein)
  6. 2693961Protein Transcriptional regulator IclR, N-terminal domain [74677] (1 species)
  7. 2693962Species Thermotoga maritima [TaxId:2336] [74678] (2 PDB entries)
  8. 2693963Domain d1jmrb3: 1jmr B:1-75 [302584]
    Other proteins in same PDB: d1jmrb4, d1jmrb5
    automated match to d1mkmb1
    complexed with co2, zn

Details for d1jmrb3

PDB Entry: 1jmr (more details), 2.2 Å

PDB Description: Crystal Structure of the Thermotoga maritima IclR
PDB Compounds: (B:) IclR transcriptional regulator

SCOPe Domain Sequences for d1jmrb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmrb3 a.4.5.33 (B:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvp
gyklieygsfvlrrf

SCOPe Domain Coordinates for d1jmrb3:

Click to download the PDB-style file with coordinates for d1jmrb3.
(The format of our PDB-style files is described here.)

Timeline for d1jmrb3: