![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.1: GroES [50130] (2 proteins) automatically mapped to Pfam PF00166 |
![]() | Protein Chaperonin-10 (GroES) [50131] (4 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [63753] (3 PDB entries) |
![]() | Domain d1jh2m_: 1jh2 M: [302582] automated match to d1p3ha_ complexed with mpd |
PDB Entry: 1jh2 (more details), 2.8 Å
SCOPe Domain Sequences for d1jh2m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jh2m_ b.35.1.1 (M:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld vaegdtviyskyggteikyngeeylilsardvlavvsk
Timeline for d1jh2m_: