SCOPe 2.06: Domain d1jgfb_: 1jgf B:

Lineage for d1jgfb_ (1jgf B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin IV [TaxId:5833] [74986] (2 PDB entries)

8. Domain d1jgfb_: 1jgf B: [302575]
   automated match to d1ls5a_
   complexed with ihn

Details for d1jgfb_

PDB Entry: 1jgf, 2.8 Å

PDB Description: crystal structure of plasmepsin iv from p. falciparum in complex with pepstatin a

PDB Compounds: (B:) plasmepsin IV

SCOPe Domain Sequences for d1jgfb_:

Sequence; same for both SEQRES and ATOM records:

>d1jgfb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin IV [TaxId: 5833]}
sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
lgdpfmrkyftvfdyekesvgfavaknl

Timeline for d1jgfb_:

• d1jgfb_ is new in SCOPe 2.06-stable
  
• d1jgfb_ appears in SCOPe 2.07
  
• d1jgfb_ appears in the current release, SCOPe 2.08