Lineage for d1jgfb_ (1jgf B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060885Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 2060930Species Plasmodium falciparum, plasmepsin IV [TaxId:5833] [74986] (2 PDB entries)
  8. 2060932Domain d1jgfb_: 1jgf B: [302575]
    automated match to d1ls5a_
    complexed with ihn

Details for d1jgfb_

PDB Entry: 1jgf (more details), 2.8 Å

PDB Description: crystal structure of plasmepsin iv from p. falciparum in complex with pepstatin a
PDB Compounds: (B:) plasmepsin IV

SCOPe Domain Sequences for d1jgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgfb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin IV [TaxId: 5833]}
sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
lgdpfmrkyftvfdyekesvgfavaknl

SCOPe Domain Coordinates for d1jgfb_:

Click to download the PDB-style file with coordinates for d1jgfb_.
(The format of our PDB-style files is described here.)

Timeline for d1jgfb_:

  • d1jgfb_ is new in SCOPe 2.06-stable