![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 proteins) automatically mapped to Pfam PF08943 |
![]() | Protein Gab protein (hypothetical protein YgaT) [63856] (1 species) unknown function |
![]() | Species Escherichia coli [TaxId:562] [63857] (2 PDB entries) |
![]() | Domain d1jfya_: 1jfy A: [302573] automated match to d1jr7a_ complexed with zn |
PDB Entry: 1jfy (more details), 2 Å
SCOPe Domain Sequences for d1jfya_:
Sequence, based on SEQRES records: (download)
>d1jfya_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli [TaxId: 562]} gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy yarfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhld dwehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfe egvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyf ayasnhyqthq
>d1jfya_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli [TaxId: 562]} gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy yarfvvknvylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehl dnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwl selsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasn hyqthq
Timeline for d1jfya_: