Lineage for d1j94c_ (1j94 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2171157Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2172311Protein automated matches [190299] (7 species)
    not a true protein
  7. 2172355Species Mus musculus [311150] (7 PDB entries)
  8. 2172369Domain d1j94c_: 1j94 C: [302562]
    Other proteins in same PDB: d1j94b_, d1j94d1, d1j94d2
    automated match to d1yroa_
    complexed with ca, udp

Details for d1j94c_

PDB Entry: 1j94 (more details), 2.5 Å

PDB Description: crystal structure of lactose synthase, complex with udp
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1j94c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j94c_ d.2.1.2 (C:) automated matches {Mus musculus}
teftkckvshaikdmdgyqgisllewacvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddiacakkivaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1j94c_:

Click to download the PDB-style file with coordinates for d1j94c_.
(The format of our PDB-style files is described here.)

Timeline for d1j94c_: