Lineage for d1j92c_ (1j92 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2925556Protein automated matches [190299] (8 species)
    not a true protein
  7. 2925635Species Mus musculus [311150] (7 PDB entries)
  8. 2925641Domain d1j92c_: 1j92 C: [302558]
    Other proteins in same PDB: d1j92b1, d1j92b2, d1j92d_
    automated match to d1yroa_
    complexed with ca, nag

Details for d1j92c_

PDB Entry: 1j92 (more details), 2 Å

PDB Description: crystal structure of lactose synthase, complex with n-acetylglucosamine
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1j92c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j92c_ d.2.1.2 (C:) automated matches {Mus musculus}
teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1j92c_:

Click to download the PDB-style file with coordinates for d1j92c_.
(The format of our PDB-style files is described here.)

Timeline for d1j92c_: