Lineage for d1j8xd_ (1j8x D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2505853Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2505854Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 2505855Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
    Uniprot P08037 131-402
  8. 2505878Domain d1j8xd_: 1j8x D: [302554]
    Other proteins in same PDB: d1j8xa_, d1j8xb2, d1j8xc_
    automated match to d1fgxb_
    complexed with ca, mn, udp

Details for d1j8xd_

PDB Entry: 1j8x (more details), 2 Å

PDB Description: crystal structure of lactose synthase, complex with udp and mn
PDB Compounds: (D:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1j8xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8xd_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
sdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1j8xd_:

Click to download the PDB-style file with coordinates for d1j8xd_.
(The format of our PDB-style files is described here.)

Timeline for d1j8xd_: