Lineage for d1j8xc_ (1j8x C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2925556Protein automated matches [190299] (8 species)
    not a true protein
  7. 2925635Species Mus musculus [311150] (7 PDB entries)
  8. 2925643Domain d1j8xc_: 1j8x C: [302553]
    Other proteins in same PDB: d1j8xb1, d1j8xb2, d1j8xd_
    automated match to d1yroa_
    complexed with ca, mn, udp

Details for d1j8xc_

PDB Entry: 1j8x (more details), 2 Å

PDB Description: crystal structure of lactose synthase, complex with udp and mn
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1j8xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8xc_ d.2.1.2 (C:) automated matches {Mus musculus}
teftkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1j8xc_:

Click to download the PDB-style file with coordinates for d1j8xc_.
(The format of our PDB-style files is described here.)

Timeline for d1j8xc_: