| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
| Protein automated matches [190299] (8 species) not a true protein |
| Species Mus musculus [311150] (7 PDB entries) |
| Domain d1j8xa_: 1j8x A: [302550] Other proteins in same PDB: d1j8xb1, d1j8xb2, d1j8xd_ automated match to d1yroa_ complexed with ca, mn, udp |
PDB Entry: 1j8x (more details), 2 Å
SCOPe Domain Sequences for d1j8xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8xa_ d.2.1.2 (A:) automated matches {Mus musculus}
teftkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp
Timeline for d1j8xa_:
View in 3DDomains from other chains: (mouse over for more information) d1j8xb1, d1j8xb2, d1j8xc_, d1j8xd_ |