Lineage for d1hwxf1 (1hwx F:209-501)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478576Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 478577Protein Glutamate dehydrogenase [51884] (7 species)
  7. 478603Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)
  8. 478609Domain d1hwxf1: 1hwx F:209-501 [30255]
    Other proteins in same PDB: d1hwxa2, d1hwxb2, d1hwxc2, d1hwxd2, d1hwxe2, d1hwxf2

Details for d1hwxf1

PDB Entry: 1hwx (more details), 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

SCOP Domain Sequences for d1hwxf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwxf1 c.2.1.7 (F:209-501) Glutamate dehydrogenase {Cow (Bos taurus)}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOP Domain Coordinates for d1hwxf1:

Click to download the PDB-style file with coordinates for d1hwxf1.
(The format of our PDB-style files is described here.)

Timeline for d1hwxf1: