SCOPe 2.07: Domain d1j8wc_: 1j8w C:

Lineage for d1j8wc_ (1j8w C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (8 species)
   not a true protein

7. Species Mus musculus [311150] (7 PDB entries)

8. Domain d1j8wc_: 1j8w C: [302548]
   Other proteins in same PDB: d1j8wb1, d1j8wb2, d1j8wd_
   automated match to d1yroa_
   complexed with ca, glc

Details for d1j8wc_

PDB Entry: 1j8w, 2 Å

PDB Description: crystal structure of lactose synthase, complex with glucose

PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1j8wc_:

Sequence; same for both SEQRES and ATOM records:

>d1j8wc_ d.2.1.2 (C:) automated matches {Mus musculus}
teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1j8wc_:

• d1j8wc_ first appeared in SCOPe 2.06
  
• d1j8wc_ appears in the current release, SCOPe 2.08