Lineage for d1j8wb1 (1j8w B:132-399)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898285Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2898286Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 2898287Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
    Uniprot P08037 131-402
  8. 2898294Domain d1j8wb1: 1j8w B:132-399 [302546]
    Other proteins in same PDB: d1j8wa_, d1j8wb2, d1j8wc_
    automated match to d1fgxb_
    complexed with ca, glc

Details for d1j8wb1

PDB Entry: 1j8w (more details), 2 Å

PDB Description: crystal structure of lactose synthase, complex with glucose
PDB Compounds: (B:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1j8wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8wb1 c.68.1.2 (B:132-399) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
sdglnsltymvlevqryplytkitvdig

SCOPe Domain Coordinates for d1j8wb1:

Click to download the PDB-style file with coordinates for d1j8wb1.
(The format of our PDB-style files is described here.)

Timeline for d1j8wb1: