![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein automated matches [190299] (8 species) not a true protein |
![]() | Species Mus musculus [311150] (7 PDB entries) |
![]() | Domain d1j8wa_: 1j8w A: [302545] Other proteins in same PDB: d1j8wb1, d1j8wb2, d1j8wd_ automated match to d1yroa_ complexed with ca, glc |
PDB Entry: 1j8w (more details), 2 Å
SCOPe Domain Sequences for d1j8wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8wa_ d.2.1.2 (A:) automated matches {Mus musculus} teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc ekp
Timeline for d1j8wa_:
![]() Domains from other chains: (mouse over for more information) d1j8wb1, d1j8wb2, d1j8wc_, d1j8wd_ |