Lineage for d1j6nd1 (1j6n D:1-291)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139874Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2139897Species Thermotoga maritima [TaxId:2336] [75312] (2 PDB entries)
    TM0665
  8. 2139905Domain d1j6nd1: 1j6n D:1-291 [302543]
    Other proteins in same PDB: d1j6na2, d1j6nb2, d1j6nc2, d1j6nd2
    automated match to d1o58a_
    complexed with po4

Details for d1j6nd1

PDB Entry: 1j6n (more details), 1.8 Å

PDB Description: Crystal structure of Cysteine synthase (TM0665) from Thermotoga maritima at 1.8 A resolution
PDB Compounds: (D:) Cysteine synthase

SCOPe Domain Sequences for d1j6nd1:

Sequence, based on SEQRES records: (download)

>d1j6nd1 c.79.1.1 (D:1-291) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]}
mmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngivept
sgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekale
isretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkg
ffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayem
arylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil

Sequence, based on observed residues (ATOM records): (download)

>d1j6nd1 c.79.1.1 (D:1-291) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]}
mmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngivept
sgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvaleisretgahmlnqfe
npynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkgffgngvkivavepa
kspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayemarylakkegllvgi
ssganvaaalkvaqklgpdarvvtvapdhaerylsil

SCOPe Domain Coordinates for d1j6nd1:

Click to download the PDB-style file with coordinates for d1j6nd1.
(The format of our PDB-style files is described here.)

Timeline for d1j6nd1:

  • d1j6nd1 is new in SCOPe 2.06-stable