Lineage for d1j5vb1 (1j5v B:1-330)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137473Family c.72.1.1: Ribokinase-like [53614] (10 protein domains)
    automatically mapped to Pfam PF00294
  6. 2137474Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 2137475Species Thermotoga maritima, TM0067 [TaxId:2336] [75296] (2 PDB entries)
  8. 2137479Domain d1j5vb1: 1j5v B:1-330 [302535]
    Other proteins in same PDB: d1j5va2, d1j5vb2
    automated match to d2afbb_
    complexed with 2of, ni, ni1, ni3, of1, zn3

Details for d1j5vb1

PDB Entry: 1j5v (more details), 2.3 Å

PDB Description: Crystal structure of 2-keto-3-deoxygluconate kinase (TM0067) from Thermotoga maritima at 2.3 A resolution
PDB Compounds: (B:) 2-keto-3-deoxygluconate kinase

SCOPe Domain Sequences for d1j5vb1:

Sequence, based on SEQRES records: (download)

>d1j5vb1 c.72.1.1 (B:1-330) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]}
mkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnpl
gdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfdw
ekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqkv
mipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktvgit
lresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkka
efaaaasclkhtipgdfvvlsieeieklas

Sequence, based on observed residues (ATOM records): (download)

>d1j5vb1 c.72.1.1 (B:1-330) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]}
mkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnpl
gdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfdw
ekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqkv
mipfmeyvdvlianeediekvlgisvenreayakiaeevtrkynfktvgitlresisatv
nywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaascl
khtipgdfvvlsieeieklas

SCOPe Domain Coordinates for d1j5vb1:

Click to download the PDB-style file with coordinates for d1j5vb1.
(The format of our PDB-style files is described here.)

Timeline for d1j5vb1:

  • d1j5vb1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1j5vb2