Lineage for d1j5rb1 (1j5r B:2-359)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249347Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2249348Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2249378Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 2249379Protein Alcohol dehydrogenase TM0920 [75612] (1 species)
  7. 2249380Species Thermotoga maritima [TaxId:2336] [75613] (3 PDB entries)
  8. 2249383Domain d1j5rb1: 1j5r B:2-359 [302531]
    Other proteins in same PDB: d1j5rb2
    automated match to d1vhda_
    complexed with fe, nap

Details for d1j5rb1

PDB Entry: 1j5r (more details), 1.4 Å

PDB Description: Crystal structure of alcohol dehydrogenase (TM0920) from Thermotoga maritima at 1.4 A resolution
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1j5rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5rb1 e.22.1.2 (B:2-359) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]}
wefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteisye
ifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedlyd
rekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysmsde
ltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfvasc
lagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhifg
gsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealgv

SCOPe Domain Coordinates for d1j5rb1:

Click to download the PDB-style file with coordinates for d1j5rb1.
(The format of our PDB-style files is described here.)

Timeline for d1j5rb1: