![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.8: GAT-like domain [89009] (3 families) ![]() |
![]() | Family a.7.8.1: GAT domain [89010] (4 proteins) this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain |
![]() | Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89012] (7 PDB entries) Uniprot Q9UJY5 211-299 |
![]() | Domain d1j2ha_: 1j2h A: [302525] automated match to d1o3xa_ |
PDB Entry: 1j2h (more details), 2.1 Å
SCOPe Domain Sequences for d1j2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2ha_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} aanklikemvqedqkrmekiskrvnaieevnnnvklltemvmshsqggaaagssedlmke lyqrcermrptlfrlasdtedndealaeilqandnltqvinlykqlvrgeev
Timeline for d1j2ha_: