Lineage for d1j2ha_ (1j2h A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310154Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 2310155Family a.7.8.1: GAT domain [89010] (4 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 2310156Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)
  7. 2310157Species Human (Homo sapiens) [TaxId:9606] [89012] (7 PDB entries)
    Uniprot Q9UJY5 211-299
  8. 2310159Domain d1j2ha_: 1j2h A: [302525]
    automated match to d1o3xa_

Details for d1j2ha_

PDB Entry: 1j2h (more details), 2.1 Å

PDB Description: Crystal structure of human GGA1 GAT domain
PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1j2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2ha_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
aanklikemvqedqkrmekiskrvnaieevnnnvklltemvmshsqggaaagssedlmke
lyqrcermrptlfrlasdtedndealaeilqandnltqvinlykqlvrgeev

SCOPe Domain Coordinates for d1j2ha_:

Click to download the PDB-style file with coordinates for d1j2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1j2ha_: