SCOPe 2.08: Domain d1iw5a1: 1iw5 A:28-113

Lineage for d1iw5a1 (1iw5 A:28-113)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.6: BolA-like [82657] (1 family)

5. Family d.52.6.1: BolA-like [82658] (3 proteins)
   Pfam PF01722

6. Protein automated matches [310842] (1 species)
   not a true protein

7. Species Mus musculus [311149] (1 PDB entry)

8. Domain d1iw5a1: 1iw5 A:28-113 [302522]
   Other proteins in same PDB: d1iw5a2
   automated match to d1v9ja_

Details for d1iw5a1

PDB Entry: 1iw5

PDB Description: Solution structure of the BolA-like protein from Mus musculus

PDB Compounds: (A:) BolA-like protein

SCOPe Domain Sequences for d1iw5a1:

Sequence; same for both SEQRES and ATOM records:

>d1iw5a1 d.52.6.1 (A:28-113) automated matches {Mus musculus}
melsadylreklrqdleaehvevedttlnrcatsfrvlvvsakfegkpllqrhrlvnecl
aeelphihafeqktltpeqwtrqrre

Timeline for d1iw5a1:

• d1iw5a1 first appeared in SCOPe 2.06
  
• d1iw5a1 appears in SCOPe 2.07