SCOPe 2.08: Domain d1iisb4: 1iis B:340-443

Lineage for d1iisb4 (1iis B:340-443)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d1iisb4: 1iis B:340-443 [302512]
   Other proteins in same PDB: d1iisc3, d1iisc4
   automated match to d1hzhh4
   complexed with man

Details for d1iisb4

PDB Entry: 1iis, 3 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (orthorhombic)

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d1iisb4:

Sequence; same for both SEQRES and ATOM records:

>d1iisb4 b.1.1.2 (B:340-443) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1iisb4:

• d1iisb4 first appeared in SCOPe 2.06
  
• d1iisb4 appears in SCOPe 2.07