Lineage for d1i99i_ (1i99 I:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568177Protein Alaserpin (serpin 1) [64469] (1 species)
  7. 2568178Species Tobacco hornworm (Manduca sexta) [TaxId:7130] [64470] (2 PDB entries)
    Michaelis serpin-trypsin complex
  8. 2568180Domain d1i99i_: 1i99 I: [302509]
    Other proteins in same PDB: d1i99e_
    automated match to d1k9oi_

Details for d1i99i_

PDB Entry: 1i99 (more details), 2.3 Å

PDB Description: crystal structure of michaelis serpin-trypsin complex
PDB Compounds: (I:) alaserpin

SCOPe Domain Sequences for d1i99i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i99i_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}
getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfvk
ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
gitaleqklkdpkalsraeerlynteveitlpkfkietttdlkevlsnmnikklftpgaa
rlenllktkesltvdaaiqkafievneegaeaaaanafgivpkslilypevhidrpfyfe
lkidgipmfngkviep

SCOPe Domain Coordinates for d1i99i_:

Click to download the PDB-style file with coordinates for d1i99i_.
(The format of our PDB-style files is described here.)

Timeline for d1i99i_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i99e_