SCOPe 2.08: Domain d1hyyl4: 1hyy L:109-211

Lineage for d1hyyl4 (1hyy L:109-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d1hyyl4: 1hyy L:109-211 [302505]
   Other proteins in same PDB: d1hyyh_, d1hyyl3
   automated match to d2jell2
   complexed with cpd

Details for d1hyyl4

PDB Entry: 1hyy, 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

PDB Compounds: (L:) immunoglobulin 6d9

SCOPe Domain Sequences for d1hyyl4:

Sequence; same for both SEQRES and ATOM records:

>d1hyyl4 b.1.1.0 (L:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1hyyl4:

• d1hyyl4 first appeared in SCOPe 2.06
  
• d1hyyl4 appears in SCOPe 2.07