Lineage for d1hyyl3 (1hyy L:1-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (159 PDB entries)
  8. 2347991Domain d1hyyl3: 1hyy L:1-108 [302504]
    Other proteins in same PDB: d1hyyl4
    automated match to d2jell1
    complexed with cpd

Details for d1hyyl3

PDB Entry: 1hyy (more details), 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog
PDB Compounds: (L:) immunoglobulin 6d9

SCOPe Domain Sequences for d1hyyl3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyyl3 b.1.1.1 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikr

SCOPe Domain Coordinates for d1hyyl3:

Click to download the PDB-style file with coordinates for d1hyyl3.
(The format of our PDB-style files is described here.)

Timeline for d1hyyl3: