Lineage for d1hyxl4 (1hyx L:109-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034634Domain d1hyxl4: 1hyx L:109-211 [302503]
    Other proteins in same PDB: d1hyxl3
    automated match to d2jell2
    complexed with cpd

Details for d1hyxl4

PDB Entry: 1hyx (more details), 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog
PDB Compounds: (L:) immunoglobulin 6d9

SCOPe Domain Sequences for d1hyxl4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyxl4 b.1.1.0 (L:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1hyxl4:

Click to download the PDB-style file with coordinates for d1hyxl4.
(The format of our PDB-style files is described here.)

Timeline for d1hyxl4: