| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
| Domain d1hyxl3: 1hyx L:1-108 [302502] Other proteins in same PDB: d1hyxl4 automated match to d2jell1 complexed with cpd |
PDB Entry: 1hyx (more details), 1.8 Å
SCOPe Domain Sequences for d1hyxl3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyxl3 b.1.1.1 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikr
Timeline for d1hyxl3: