SCOPe 2.08: Domain d1hyxl3: 1hyx L:1-108

Lineage for d1hyxl3 (1hyx L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d1hyxl3: 1hyx L:1-108 [302502]
   Other proteins in same PDB: d1hyxl4
   automated match to d2jell1
   complexed with cpd

Details for d1hyxl3

PDB Entry: 1hyx, 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

PDB Compounds: (L:) immunoglobulin 6d9

SCOPe Domain Sequences for d1hyxl3:

Sequence; same for both SEQRES and ATOM records:

>d1hyxl3 b.1.1.1 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikr

Timeline for d1hyxl3:

• d1hyxl3 first appeared in SCOPe 2.06
  
• d1hyxl3 appears in SCOPe 2.07