Lineage for d1hwxf3 (1hwx F:1-208)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) 
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
Protein Glutamate dehydrogenase [53225] (8 species) 
Species Cow (Bos taurus) [TaxId:9913] [53230] (8 PDB entries) 
Domain d1hwxf3: 1hwx F:1-208 [302500]
Other proteins in same PDB: d1hwxa4, d1hwxb4, d1hwxc4, d1hwxd4, d1hwxe4, d1hwxf4
automated match to d1hwza2
complexed with glu, gtp, nai
Details for d1hwxf3
PDB Entry: 1hwx (more details), 2.5 Å
PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid
PDB Compounds: (F:) glutamate dehydrogenaseSCOPe Domain Sequences for d1hwxf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwxf3 c.58.1.1 (F:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi
SCOPe Domain Coordinates for d1hwxf3:
Click to download the PDB-style file with coordinates for d1hwxf3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hwxf3:
View in 3D
