| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein Glutamate dehydrogenase [51884] (8 species) |
| Species Cow (Bos taurus) [TaxId:9913] [51889] (6 PDB entries) |
| Domain d1hwxc4: 1hwx C:209-501 [302495] Other proteins in same PDB: d1hwxa3, d1hwxb3, d1hwxc3, d1hwxd3, d1hwxe3, d1hwxf3 automated match to d1hwza1 complexed with glu, gtp, nai has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1hwx (more details), 2.5 Å
SCOPe Domain Sequences for d1hwxc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwxc4 c.2.1.7 (C:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
Timeline for d1hwxc4: