Lineage for d1hu4a_ (1hu4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841715Protein Carbonyl reductase/20beta-hydroxysteroid dehydrogenase [63935] (2 species)
  7. 2841726Species Pig (Sus scrofa) [TaxId:9823] [63936] (2 PDB entries)
  8. 2841727Domain d1hu4a_: 1hu4 A: [302489]
    automated match to d1n5da_
    complexed with ndp, so4

Details for d1hu4a_

PDB Entry: 1hu4 (more details), 2.3 Å

PDB Description: crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
PDB Compounds: (A:) carbonyl reductase/20beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d1hu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hu4a_ c.2.1.2 (A:) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
ssntrvalvtgankgigfaivrdlcrqfagdvvltardvargqaavkqlqaeglsprfhq
ldiidlqsiralcdflrkeyggldvlvnnaaiafqldnptpfhiqaeltmktnfmgtrnv
ctellplikpqgrvvnvsstegvralnecspelqqkfksetiteeelvglmnkfvedtkn
gvhrkegwsdstygvtkigvsvlsriyarklreqragdkillnaccpgwvrtdmggpkap
kspevgaetpvylallpsdaegphgqfvtdkkvvewgvppesypwvna

SCOPe Domain Coordinates for d1hu4a_:

Click to download the PDB-style file with coordinates for d1hu4a_.
(The format of our PDB-style files is described here.)

Timeline for d1hu4a_: