Lineage for d1hlra8 (1hlr A:311-907)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540625Family d.133.1.0: automated matches [310666] (1 protein)
    not a true family
  6. 2540626Protein automated matches [310841] (1 species)
    not a true protein
  7. 2540627Species Desulfovibrio gigas [TaxId:879] [311147] (1 PDB entry)
  8. 2540628Domain d1hlra8: 1hlr A:311-907 [302488]
    Other proteins in same PDB: d1hlra5, d1hlra6, d1hlra7
    automated match to d1dgja4
    complexed with cl, fes, ipa, mg, pcd

Details for d1hlra8

PDB Entry: 1hlr (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1hlra8:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlra8 d.133.1.0 (A:311-907) automated matches {Desulfovibrio gigas [TaxId: 879]}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsreqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOPe Domain Coordinates for d1hlra8:

Click to download the PDB-style file with coordinates for d1hlra8.
(The format of our PDB-style files is described here.)

Timeline for d1hlra8: