![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
![]() | Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
![]() | Protein automated matches [230465] (4 species) not a true protein |
![]() | Species Desulfovibrio gigas [TaxId:879] [311146] (1 PDB entry) |
![]() | Domain d1hlra7: 1hlr A:194-310 [302487] Other proteins in same PDB: d1hlra5, d1hlra6, d1hlra8 automated match to d1dgja3 complexed with cl, fes, ipa, mg, pcd |
PDB Entry: 1hlr (more details), 1.28 Å
SCOPe Domain Sequences for d1hlra7:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlra7 d.41.1.0 (A:194-310) automated matches {Desulfovibrio gigas [TaxId: 879]} dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay
Timeline for d1hlra7: