Lineage for d1hlra7 (1hlr A:194-310)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944851Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2944937Family d.41.1.0: automated matches [230464] (1 protein)
    not a true family
  6. 2944938Protein automated matches [230465] (4 species)
    not a true protein
  7. 2944962Species Desulfovibrio gigas [TaxId:879] [311146] (1 PDB entry)
  8. 2944963Domain d1hlra7: 1hlr A:194-310 [302487]
    Other proteins in same PDB: d1hlra5, d1hlra6, d1hlra8
    automated match to d1dgja3
    complexed with cl, fes, ipa, mg, pcd

Details for d1hlra7

PDB Entry: 1hlr (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1hlra7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlra7 d.41.1.0 (A:194-310) automated matches {Desulfovibrio gigas [TaxId: 879]}
dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg
litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay

SCOPe Domain Coordinates for d1hlra7:

Click to download the PDB-style file with coordinates for d1hlra7.
(The format of our PDB-style files is described here.)

Timeline for d1hlra7: