![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
![]() | Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) ![]() contains 2Fe-2S cluster |
![]() | Family a.56.1.0: automated matches [227241] (1 protein) not a true family |
![]() | Protein automated matches [227007] (6 species) not a true protein |
![]() | Species Desulfovibrio gigas [TaxId:879] [311145] (1 PDB entry) |
![]() | Domain d1hlra6: 1hlr A:81-193 [302486] Other proteins in same PDB: d1hlra5, d1hlra7, d1hlra8 automated match to d1dgja1 complexed with cl, fes, ipa, mg, pcd |
PDB Entry: 1hlr (more details), 1.28 Å
SCOPe Domain Sequences for d1hlra6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlra6 a.56.1.0 (A:81-193) automated matches {Desulfovibrio gigas [TaxId: 879]} qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl
Timeline for d1hlra6: