SCOPe 2.07: Domain d1hkeb1: 1hke B:2-129

Lineage for d1hkeb1 (1hke B:2-129)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
   alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet

4. Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family)
   automatically mapped to Pfam PF08816

5. Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)

6. Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
   formerly hypothetical protein YkfE

7. Species Pseudomonas aeruginosa [TaxId:287] [89876] (2 PDB entries)

8. Domain d1hkeb1: 1hke B:2-129 [302475]
   Other proteins in same PDB: d1hkea2, d1hkeb2, d1hkec_, d1hked_
   automated match to d1uuza_

Details for d1hkeb1

PDB Entry: 1hke, 1.8 Å

PDB Description: ivy:a new family of protein

PDB Compounds: (B:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1hkeb1:

Sequence; same for both SEQRES and ATOM records:

>d1hkeb1 d.233.1.1 (B:2-129) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]}
eqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansckp
hdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmkq
lesdpnwk

Timeline for d1hkeb1:

• d1hkeb1 first appeared in SCOPe 2.06
  
• d1hkeb1 appears in the current release, SCOPe 2.08