Lineage for d1hkea1 (1hke A:1-129)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614178Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 2614179Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
    automatically mapped to Pfam PF08816
  5. 2614180Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)
  6. 2614181Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 2614188Species Pseudomonas aeruginosa [TaxId:287] [89876] (2 PDB entries)
  8. 2614191Domain d1hkea1: 1hke A:1-129 [302473]
    Other proteins in same PDB: d1hkea2, d1hkeb2, d1hkec_, d1hked_
    automated match to d1uuza_

Details for d1hkea1

PDB Entry: 1hke (more details), 1.8 Å

PDB Description: ivy:a new family of protein
PDB Compounds: (A:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1hkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkea1 d.233.1.1 (A:1-129) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]}
eeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansck
phdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmk
qlesdpnwk

SCOPe Domain Coordinates for d1hkea1:

Click to download the PDB-style file with coordinates for d1hkea1.
(The format of our PDB-style files is described here.)

Timeline for d1hkea1: