![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily) alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet |
![]() | Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) ![]() automatically mapped to Pfam PF08816 |
![]() | Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins) |
![]() | Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species) formerly hypothetical protein YkfE |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [89876] (2 PDB entries) |
![]() | Domain d1hkea1: 1hke A:1-129 [302473] Other proteins in same PDB: d1hkea2, d1hkeb2, d1hkec_, d1hked_ automated match to d1uuza_ |
PDB Entry: 1hke (more details), 1.8 Å
SCOPe Domain Sequences for d1hkea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkea1 d.233.1.1 (A:1-129) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]} eeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansck phdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmk qlesdpnwk
Timeline for d1hkea1:
![]() Domains from other chains: (mouse over for more information) d1hkeb1, d1hkeb2, d1hkec_, d1hked_ |