![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
![]() | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
![]() | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
![]() | Protein MS2 virus coat protein [55407] (1 species) |
![]() | Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries) Uniprot P03612 |
![]() | Domain d1he6b_: 1he6 B: [302469] automated match to d1zdha_ protein/RNA complex |
PDB Entry: 1he6 (more details), 2.65 Å
SCOPe Domain Sequences for d1he6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he6b_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d1he6b_: