SCOPe 2.06: Domain d1he6b_: 1he6 B:

Lineage for d1he6b_ (1he6 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
   Uniprot P03612

8. Domain d1he6b_: 1he6 B: [302469]
   automated match to d1zdha_
   protein/RNA complex

Details for d1he6b_

PDB Entry: 1he6, 2.65 Å

PDB Description: ms2-rna hairpin (ade-5) virus complex

PDB Compounds: (B:) coat protein ms2

SCOPe Domain Sequences for d1he6b_:

Sequence; same for both SEQRES and ATOM records:

>d1he6b_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d1he6b_:

• d1he6b_ is new in SCOPe 2.06-stable
  
• d1he6b_ appears in SCOPe 2.07
  
• d1he6b_ appears in the current release, SCOPe 2.08