Lineage for d1hdwc_ (1hdw C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962492Protein MS2 virus coat protein [55407] (1 species)
  7. 2962493Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2962506Domain d1hdwc_: 1hdw C: [302465]
    automated match to d1zdha_
    protein/RNA complex

Details for d1hdwc_

PDB Entry: 1hdw (more details), 2.6 Å

PDB Description: ms2-rna hairpin (2thio-u-5-6) complex
PDB Compounds: (C:) coat protein ms2

SCOPe Domain Sequences for d1hdwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdwc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1hdwc_:

Click to download the PDB-style file with coordinates for d1hdwc_.
(The format of our PDB-style files is described here.)

Timeline for d1hdwc_: