![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) ![]() contains barrel, closed, n=7, S=10 |
![]() | Family c.8.1.0: automated matches [310665] (1 protein) not a true family |
![]() | Protein automated matches [310840] (3 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [311142] (1 PDB entry) |
![]() | Domain d1h6za5: 1h6z A:406-537 [302457] Other proteins in same PDB: d1h6za4, d1h6za6 automated match to d2x0sa2 |
PDB Entry: 1h6z (more details), 3 Å
SCOPe Domain Sequences for d1h6za5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6za5 c.8.1.0 (A:406-537) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} pnlepgaekankpigrglaaspgaavgqvvfdaesakewsgrgkkvimvrletspedlag mdaacgiltarggmtshaavvargmgkccvsgcgdmvirgksfklngsvfregdyitidg skgliyagklkl
Timeline for d1h6za5: