Lineage for d1gtxd_ (1gtx D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132092Species Wild boar (Sus scrofa) [311140] (1 PDB entry)
  8. 2132096Domain d1gtxd_: 1gtx D: [302450]
    automated match to d4y0hd_
    complexed with act, plp

Details for d1gtxd_

PDB Entry: 1gtx (more details), 3 Å

PDB Description: 4-aminobutyrate-aminotransferase from pig
PDB Compounds: (D:) protein (4-aminobutyrate aminotransferase)

SCOPe Domain Sequences for d1gtxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtxd_ c.67.1.4 (D:) automated matches {Wild boar (Sus scrofa)}
fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
itmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdysilsfmgafh
grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
wahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk

SCOPe Domain Coordinates for d1gtxd_:

Click to download the PDB-style file with coordinates for d1gtxd_.
(The format of our PDB-style files is described here.)

Timeline for d1gtxd_:

  • d1gtxd_ is new in SCOPe 2.06-stable