Lineage for d1gt2b3 (1gt2 B:22-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844748Protein Malate dehydrogenase [51849] (13 species)
  7. 2844801Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries)
  8. 2844809Domain d1gt2b3: 1gt2 B:22-162 [302445]
    Other proteins in same PDB: d1gt2a4, d1gt2b4
    automated match to d1o6za1
    complexed with cl, na, nad; mutant

Details for d1gt2b3

PDB Entry: 1gt2 (more details), 2.91 Å

PDB Description: r207s,r292s mutant of malate dehydrogenase from the halophilic archaeon haloarcula marismortui (holo form)
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1gt2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt2b3 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

SCOPe Domain Coordinates for d1gt2b3:

Click to download the PDB-style file with coordinates for d1gt2b3.
(The format of our PDB-style files is described here.)

Timeline for d1gt2b3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gt2b4