Lineage for d1gr8a_ (1gr8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921622Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2921623Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2921624Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)
  6. 2921654Protein Malonamidase E2 [75306] (1 species)
  7. 2921655Species Bradyrhizobium japonicum [TaxId:375] [75307] (15 PDB entries)
  8. 2921658Domain d1gr8a_: 1gr8 A: [302435]
    automated match to d1ocka_

Details for d1gr8a_

PDB Entry: 1gr8 (more details), 1.8 Å

PDB Description: the crystal structure of malonamidase e2 from bradyrhizobium japonicum
PDB Compounds: (A:) malonamidase e2

SCOPe Domain Sequences for d1gr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gr8a_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak

SCOPe Domain Coordinates for d1gr8a_:

Click to download the PDB-style file with coordinates for d1gr8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gr8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gr8b_