![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 proteins) has slightly different topology than other families do |
![]() | Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56238] (7 PDB entries) Uniprot P17169 1-238 |
![]() | Domain d1gmse_: 1gms E: [302433] automated match to d1xffa_ complexed with act, hga, na |
PDB Entry: 1gms (more details), 1.85 Å
SCOPe Domain Sequences for d1gmse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmse_ d.153.1.1 (E:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]} cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl
Timeline for d1gmse_: