SCOPe 2.05: Domain d2tmgf1: 2tmg F:179-411

Lineage for d2tmgf1 (2tmg F:179-411)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (8 species)

7. Species Thermotoga maritima [TaxId:2336] [51888] (3 PDB entries)

8. Domain d2tmgf1: 2tmg F:179-411 [30243]
   Other proteins in same PDB: d2tmga2, d2tmgb2, d2tmgc2, d2tmgd2, d2tmge2, d2tmgf2
   mutant

Details for d2tmgf1

PDB Entry: 2tmg, 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

PDB Compounds: (F:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d2tmgf1:

Sequence; same for both SEQRES and ATOM records:

>d2tmgf1 c.2.1.7 (F:179-411) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr

Timeline for d2tmgf1:

• d2tmgf1 first appeared (with stable ids) in SCOP 1.55
  
• d2tmgf1 appears in SCOPe 2.04
  
• d2tmgf1 appears in SCOPe 2.06
  
• d2tmgf1 appears in the current release, SCOPe 2.08