![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Glutamate dehydrogenase [51884] (7 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries) |
![]() | Domain d2tmgf1: 2tmg F:179-411 [30243] Other proteins in same PDB: d2tmga2, d2tmgb2, d2tmgc2, d2tmgd2, d2tmge2, d2tmgf2 |
PDB Entry: 2tmg (more details), 2.9 Å
SCOP Domain Sequences for d2tmgf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tmgf1 c.2.1.7 (F:179-411) Glutamate dehydrogenase {Thermotoga maritima} ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr
Timeline for d2tmgf1: